PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462857158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family Nin-like
Protein Properties Length: 825aa    MW: 92003.6 Da    PI: 7.4058
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462857158genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.17.3e-28497548152
     RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                aek+isl+++++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+R+i+++
  462857158 497 AEKTISLDVIQQYFSGSLKSAAKSLGVCPTTMKRICRQHGISRWPSRQISKV 548
                589**********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.234487568IPR003035RWP-RK domain
PfamPF020427.8E-25500548IPR003035RWP-RK domain
SuperFamilySSF542771.11E-18739823No hitNo description
SMARTSM006662.5E-14749820IPR000270PB1 domain
PROSITE profilePS5174515.524749822IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.6E-19750824No hitNo description
PfamPF005641.8E-12750814IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MLLAFGFFYA LVVKLVGNSE TTEIGEYFNG KCQVHLSLVD DYSDSSFFLK QRLTLALRYL  60
KESTNQHLLV QIWAPIRNGG RYIRSTSGQP FVLDQRSIGL LQYRAISMMY TFSIDGDSLQ  120
DLGLPGRVFK QRVPEWTPNV QYYRSTEYAR LDHAISYNVH GTVALPVFDP TVKSCIAVLE  180
LIMTSKKINY SSEIDKVCKA LETVNLRSTE VIEHPYICNE RHQAALADML EVLTVTCEEL  240
KLPLAQTWVP CKYQNLLTHF GGVKKSCFSA HESCVQESCM SASDVAFHVT DAFMWGFRDA  300
CVAHHLLKGQ GVSGKAFILR RPCFSSDVTR FSKMEYELVH YARMFGLAGC FSICLQSAYT  360
GNDDYILEFF LPPDCRNNDD QKVLLGSILA VLRQHLHSLR VATDDGSNEV CLQVGAITVI  420
GNEEIEDAHI HHLNFKSGMH GTKESDSMTI ISSTNYERRL LHENEFKCHA KTTSDFTSDS  480
SLVDINGKHN GRRRGKAEKT ISLDVIQQYF SGSLKSAAKS LGVCPTTMKR ICRQHGISRW  540
PSRQISKVNR SISRLKKVIE SVEGPEGAFN LTAITCPVSV PFRQFSSLNK EKGRENKVTE  600
VSIPSAQERK GSPSHNKPLE SGGLLRTSRS QHPFLADIST LVEVEKASNL RSSSGEPSTR  660
SGTSDESCHG SPANNTLDVS VTLVEPQQNM CKQDELKEEP SQGQNLLFSS LFANGSESSR  720
HFRNRAISSV TQPTVAPTGN LMSVQNSDII TVKACYKDAI LRFRFPLSGS FVALKDEVAK  780
RVQMDAGLFD IKYLDDENEW VKLTCDADLA ECLDISLLPG TSVLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960682.10.0PREDICTED: protein NLP3-like isoform X1
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLK3Z3P20.0K3Z3P2_SETIT; Uncharacterized protein
STRINGSi021160m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein